Product Name :
Stresscopin (human) peptide
Sequence Shortening :
TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
Sequence :
H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
Length (aa) :
40
Peptide Purity (HPLC) :
97.8%
Molecular Formula :
C195H326N56O53S2
Molecular Weight :
4367.21
Source :
Synthetic
Form :
Powder
Description :
This peptide is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2). Transcripts are expressed in brain and most tissues analyzed. Intraperitoneal injections of stresscopin suppresses heat-induced edema formation in anesthetized rats. It also decreases food intake and exhibits an inhibitory effect on gastric emptying activity. This CRHR2 agonist might represent an endogenous ligand for maintaining homeostasis after stress.
Storage Guidelines :
Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
References :
S.Y.Hsu et al., Nat. Med., 7, 605 (2001)
About TFA salt :
Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process. TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product. TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations. In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.
Related websites: https://www.medchemexpress.com/peptides/Peptide_Protein.html
Popular product recommendations:
HY-137337
HY-W141932
